General Information

  • ID:  hor004242
  • Uniprot ID:  Q5KT11
  • Protein name:  Thyroliberin
  • Gene name:  trh
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  TRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008437 thyrotropin-releasing hormone activity
  • GO BP:  GO:0009755 hormone-mediated signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QHP
  • Length:  3(65-67)
  • Propeptide:  MRAACVILLASLTVSVSPGGQAQALPGEGDPSLDELLQLLRSMLTQMEDENHANGEQTEWLEKRQHPGKREEDGGRLRRQHPGKRLSLEQVMLEEPSEQSELSKRQHPGKRYLMLLHKRQHPGRRELQEASLAKRQHPGKRLCEDWSETGCDPASVLLELLDRSGAEEKRQHPGKRLELEDDLTEQE
  • Signal peptide:  MRAACVILLASLTVSVSPGGQA
  • Modification:  T1 Pyrrolidone carboxylic acid;T3 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: ~20 minutes; /1200 seconds ( PubMed ID: 17498958 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5KT11-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004242_AF2.pdbhor004242_ESM.pdb

Physical Information

Mass: 41626 Formula: C16H24N6O5
Absent amino acids: ACDEFGIKLMNRSTVWY Common amino acids: HPQ
pI: 7.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 0
Hydrophobicity: -276.67 Boman Index: -1020
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -293.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature